As we start using our new device, we forget about the old one. However, do you know that you can still make use of your old device? Your abandoned electronic gadgets are virtual gold mines. List of 10 Handy Uses for Your Old Android/iOS Devices You just need to find the right way to tap into their potential and give them a new life. So, in this article, we will share a few handy uses of your old Android smartphone/tablet....
However, it is not the only thing the well-known Chinese smartphone manufacturer Xiaomi has developed. They also have smart devices for our needs, like smart bracelets, smartwatches, smart home appliances, and smartpens. List of 10 Must-Have MIUI Apps That You Should Try But, now we will tell you the applications of Xiaomi, of course, MIUI apps that you can use on your devices, and the most interesting thing is that you can use all these apps on any Android device, as it is not necessary to have a mobile from the Chinese brand itself to use all these apps....
Anvita Prashant Telang is a student from Vibgyor High School in Belawadi, she is pursuing sixth standard and was chosen for her Doodle submission on the theme titled “If i could teach anyone anything, it would be” Sapna Chadha, Head of Marketing, Google India in a statement said “With ‘Doodle 4 Google’ competition, we aim to promote creativity, passion, and imagination in younger users. We congratulate Anvita for being judged as the winner this year” The entries have come from over 50 cities across the country and were judged on artistic merit, imagination, and theme communication as well as their unique and novel approach to the Doodle....
Joel Tapia So without further ado, here are the 13 games that we are predicting as the most likely to appear during the Disney and Marvel Games Showcase. First, let’s start by talking about the games that have either been officially confirmed or teased as ones that will be showing up at the event. Disney Dreamlight Valley The upcoming life-sim adventure game, Disney Dreamlight Valley, is confirmed to be showing up at the event though what precisely they plan on showing is a bit of a mystery....
Android is an open-source operating system. However, most apps we find in the Google play store are not open source. We can get a wide range of apps on the Play store; however, only a few Android apps are open source. List of 20 Best Free and Open Source Android Apps Open Source apps are usually free, and they don’t show ads. They also have added benefits for app developers....
So, if you are willing to learn ethical hacking, you need to use some tools. These tools would help you ease out many complicated things in the security field. Here we have compiled a list of the best hacking tools with descriptions and features. Also Read: Best Android Hacking Apps 20 Best Hacking Tools For Windows, Linux, and Mac OS X So, in this article, we will share a list of the best hacking tools for Windows, Linux, and Mac OS X....
Hence, if you have just installed the WhatsApp app and don’t know the things you can do with it, you may find this guide very useful. In this article, we have listed some of the best WhatsApp tips and tricks that will help you utilize the app at its best. List of 20 Best WhatsApp Tips & Tricks From message reactions to voice calling features to WhatsApp payments, we have listed all possible tips & tricks we can recall in this guide....
On average, an Android user installs almost 30-40 apps on their smartphone. While installing an app, we don’t care about knowing its version. However, the Android app version can tell you whether a particular feature is available or not. Also Read: How to Recover Deleted Files On Android Find Out What Version of an Android App You’re Running If a particular app is not available on the Google Play Store, users can sideload apps from third-party stores....
Keenan McCall and Andrew McMahon Since the medium was first created, we’ve seen a number of great fights, but these ones, in particular, are among the best anime fights of all time. If you’re interested in reading about more anime, check out what we had to say about the best anime villains, anime senpai, and more! Warning: Major Spoilers For Multiple Series Ahead Asuka Vs. The Mass Production Evangelions (The End of Evangelion) For all of the guff the End of Evangelion movies get from fans, it’s undeniable that the battle between EVA Unit 02 pilot Asuka Langley and the Mass Production Evangelions is amazing....
The instant messaging apps keep getting updates in regular intervals. Here we are going to share five such updates that Facebook-owned WhatsApp got recently. #1 Pinned Chats The instant messaging application WhatsApp now allows you to pin your favorite chats at the top of the main window. You just need to long press the chat and you will see the ‘Pin’ icon located on the top. This functionality allows users to pin a maximum number of 3 chats to the top....
The most noticeable feature of OnePlus 7 Pro is its triple camera setup. The primary camera sensor of OnePlus 7 Pro is of 48 megapixels which on paper looks unbeatable. Still, when it comes to the actual camera performance, the smartphone lags behind the Samsung Galaxy S10 Plus. Some of the OnePlus 7 Pro users have claimed that they are getting a warm tint on photos while using the stock camera app....
Well, if we look around, we will find that most of us rely on Google Chrome web browser to surf the internet. Google Chrome is available on every major platform including iOS, Android, Windows, Linux, etc. Google Chrome is indeed a great and most conventional browser ever made. However, Google Chrome lacks visual appeals, and it only offers few customization options like you can apply a theme to customize the look and feel....
Jake Su Note that the following list of words has been tested and are functional answers in Wordle. However, if you spot any missing or incorrect words, please let us know via the comments below so we can take a look at the list and update it if necessary. 5 Letter Words Starting With B & Ending With H baithbandhbatchbeachbeathbeechbekahbelahbelchbenchberthbiachbimahbirchbirthblashblechblushbokehboothbotchboughbrachbrashbrithbrochbroghbrothbrughbrushbumphbunchbundhburghbutchbutoh Armed with this list, you can have an easier time trying to figure out the right answer for the day....
Jake Su The following list of words has been tested in Wordle and works as guesses. However, if there are any missing or incorrect words, please let us know in the comments below so we can investigate and update if necessary. All 5 Letter Words Starting with FL flabsflackflaffflagsflailflairflakeflaksflakyflameflammflamsflamyflaneflankflansflapsflareflaryflashflaskflatsflavaflawnflawsflawyflaxyflaysfleamfleasfleckfleekfleerfleesfleetflegsflemefleshfleurflewsflexiflexofleysflickflicsfliedflierfliesflimpflimsflingflintflipsflirsflirtfliskfliteflitsflittfloatflobsflockflocsfloesflogsflongfloodfloorflopsfloraflorsfloryfloshflossflotafloteflourfloutflownflowsflubsfluedfluesflueyflufffluidflukeflukyflumeflumpflungflunkfluorflurrflushfluteflutyfluytflybyflyerflypeflyte With your chosen answer in mind, it is time to try it out in Wordle. Use the in-game keyboard to key in your guess, and use the colors as your guide....
Zhiqing Wan 5 Letter Words Starting With W and Ending With P WatapWhaupWheepWhelpWhompWhoopWhump The good news here is that the list of possible answers is very short, so you shouldn’t have too much trouble nailing it down before you run out of attempts. Another thing to keep in mind is that while it can seem impossible to guess the word at times, Wordle tends to use words that are actually pretty commonly known among English speakers....
Jake Su Note that the following list of words has been tested and are functional answers in Wordle. However, if you spot any missing or incorrect words, please let us know via the comments below so we can take a look at the list and update it if necessary. All 5 Letter Words With U as the First & Third Letters uhuruurubuusualusureusurpusuryuvula Even with the list of possible words, it is not a guarantee that you will arrive at the right answer before it is too late....
It sounds really odd, right, as it should be. So, just think about how much risk we are taking. 6 Out Of 10 PCs In The World Run Outdated Versions Of Windows At present, 91.59% of the computers that exist in the world run under the Windows operating system. An overwhelming domain hides an alarming truth: 64.79% of those computers work with an outdated version of Windows. Not surprisingly, Windows 7 remains the most democratized operating system globally, with a deployment rate of 48....
Chloe got a personal response from Google CEO Sundar Pichai, Sundar Pichai said that Google would be waiting for her job application in the future and also motivated Chloe Bridgewater to work hard and follow her dreams. — Andy Bridgewater 🇬🇧 (@B21DGY) February 13, 2017 Well, the reason why I am talking about Chloe Bridgewater today is because she is making the headlines again. She just bagged her first job as a product tester along with her 5-Year-Old sister Hollie at a tech company named Kano....
This could eventually disturb you in your tasks, projects and can also irritate you! Although you can disable the Speaker to get rid of those irritating sounds, we all know that’s not a permanent fix. So, if you are also facing such sound issues, you can read some of the best methods given below. Not just the crackling or popping sounds, but these methods will fix most of the sound-related problems on your Windows 10 pc....
Dylan Chaundy Case in point: a certain fantasy-action pic that sees Matt Damon battling ancient monsters has slayed its way to the sixth spot on Netflix’s most-watched charts, according to FlixPatrol. The specific film in question is 2017’s The Great Wall, which has come out of nowhere and managed to crack the streaming giant’s Top 10 charts today. Boasting a mammoth budget of $150 million, The Great Wall is the first english language film directed by acclaimed Chinese filmmaker Zhang Yimou, the helmsman behind award-winning martial arts movies like 2002’s Hero, 2004’s House of Flying Daggers, and 2006’s Curse of the Golden Flower....
